PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10019755m
Common NameEUTSA_v10019755mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family ARR-B
Protein Properties Length: 871aa    MW: 97512.1 Da    PI: 4.4726
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10019755mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like41.43.2e-13237286555
          G2-like   5 rWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      +Wt+e   +F+ a++ L G++   Pk+il +m+  +L l +v SHLQkY+ 
  Thhalv10019755m 237 VWTQERQMKFLTAISIL-GEKDSRPKSILSIMNDADLNLRQVGSHLQKYKA 286
                      6****************.9999***************************85 PP

2Response_reg33.32.5e-12231291109
                      EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH.ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTT CS
     Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd.pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaG 93 
                      vlivd + +  e l+++l++    +v ++  +++al ++++++ ++l++   emp++d + +l+ +  +e  +p i++  + + + a + l   
  Thhalv10019755m  23 VLIVDNDTTSIEYLTSMLKQFSD-KVMSVNMASDALSMIEKQKdIGLVIANTEMPRIDSHSFLTALLHKE--IPLILIHPEINTKEASDLLTKS 113
                      8******************7777.88888888888888866555**********************7766..9********************* PP

                      ESEEEESS--HHHHHH CS
     Response_reg  94 akdflsKpfdpeelvk 109
                       + +l Kp++++++ +
  Thhalv10019755m 114 THFCLKKPISESDIKN 129
                      **********999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521723.56E-1219150IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23007.6E-1520157No hitNo description
PROSITE profilePS5011023.58222135IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.2E-923129IPR001789Signal transduction response regulator, receiver domain
CDDcd001563.38E-624134No hitNo description
SuperFamilySSF466893.05E-9234287IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.3E-14237288IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-12237286IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 871 aa     Download sequence    Send to blast
MTEKLTLNLA GNTTAEHISD ISVLIVDNDT TSIEYLTSML KQFSDKVMSV NMASDALSMI  60
EKQKDIGLVI ANTEMPRIDS HSFLTALLHK EIPLILIHPE INTKEASDLL TKSTHFCLKK  120
PISESDIKNL WQHVVPKESQ KLEKINISEQ QEKVVEKTML NQIESFRETI KRQRISQSSL  180
LGKQPFVKTF TTPKTYQKRK EKAIDEGNTK PVYPTEAENK REEGIKMGSN IGRRCNVWTQ  240
ERQMKFLTAI SILGEKDSRP KSILSIMNDA DLNLRQVGSH LQKYKAQVEL MNDSLSRNEW  300
RSTDKIFNYP SDYKYPFNAS NLAKNIVESN TKWYSLRKKE ASSSSIDQYS FKKSADKGKA  360
KMMPKFHLGG KLDLSKHSLF DNVLNKSPME FKYVPSATSN KPHVLSSTND VNNSVLSSDN  420
PPVLSGLPLS VDASNHSGLS NNLPVLFGLP SSVGASKHNG LGYDSPSVLS GLPSNVGVPN  480
HNGLSDNPSV LSGLPTSVGA SNTDAFQMGS SEICIAQSEP NPFQPSSSVL EIDWNQLDLD  540
PISTPDPYVP LADLCTIGES YFLPDLVFTM NPLETNMDQI GWIPSTDNIS DETNMNQMGW  600
TPSTENFSHP ETNMNQMDWI PTLENYVFPQ TDMNINVPET NTTHMGWVSS REGYVASENI  660
IPSEISNQMD RVSYGENHVL SQDIISHVGF ATGQTNYETP SQTNTDQMNW LFSEESFLLL  720
EDIPFLETIT AQTLETNMED TSLVPYVEDT DCPIEELISL DIDVNEMDID CWFGNYGSSE  780
ENIPLSTMYI GHDSAFNSLM DSTPHSTMEN NDQSLGMNLE STSQQHNMME PCRYQHMKTE  840
NPREAMEGGD HFDDDPECMS WIDEMINDNA *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006391170.10.0hypothetical protein EUTSA_v10019755mg
TrEMBLV4MB840.0V4MB84_EUTSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM136851424
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68210.10.0pseudo-response regulator 6